PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004486311.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 221aa    MW: 24879.2 Da    PI: 9.7202
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004486311.2genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-3350103255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH++Fv+av++LGG+++AtPk +l+lm+vkgLt++hvkSHLQ+YR+
  XP_004486311.2  50 PRLRWTPDLHRCFVHAVHRLGGEDRATPKLVLQLMNVKGLTISHVKSHLQMYRS 103
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-3346105IPR009057Homeodomain-like
PROSITE profilePS5129411.46146106IPR017930Myb domain
SuperFamilySSF466891.79E-1648104IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-2450104IPR006447Myb domain, plants
PfamPF002494.5E-1051102IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MSSSSSSLIS GVVDNNPSSH LTQLRTPSHL IQQMSLKPPM VRPYVRSKMP RLRWTPDLHR  60
CFVHAVHRLG GEDRATPKLV LQLMNVKGLT ISHVKSHLQM YRSMKHEQMN EAAARKNNMA  120
LLGSTESSSA VVPSCGTEDL ARTQTQRNGY EPESSYNNES IIIGDGHNQK MHTYIIFKGI  180
LRTDTVQANI REHQRGSLHE LLTRSEARED TNDVSLELTL T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004486311.21e-165PREDICTED: probable transcription factor KAN2
TrEMBLA0A072V6D01e-72A0A072V6D0_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA09G00685.13e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93812840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.12e-36G2-like family protein